Lineage for d1ulxa_ (1ulx A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345656Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2345657Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2345658Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2345704Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2345764Species Norway rat (Rattus norvegicus) [TaxId:10116] [48617] (25 PDB entries)
    Uniprot P06762 11-222
  8. 2345771Domain d1ulxa_: 1ulx A: [107941]
    complexed with cmo, hem

Details for d1ulxa_

PDB Entry: 1ulx (more details), 2 Å

PDB Description: partially photolyzed structure of co-bound heme-heme oxygenase complex
PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d1ulxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulxa_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
mtpevkhrvteeaktafllnielfeelqallt

SCOPe Domain Coordinates for d1ulxa_:

Click to download the PDB-style file with coordinates for d1ulxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ulxa_: