![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
![]() | Protein Biphenyl dioxygenase large subunit BphA1, C-terminal domain [111166] (1 species) |
![]() | Species Rhodococcus sp. RHA1 [TaxId:101510] [111167] (2 PDB entries) Uniprot Q53122 17-451 |
![]() | Domain d1ulje2: 1ulj E:171-451 [107937] Other proteins in same PDB: d1ulja1, d1uljb_, d1uljc1, d1uljd_, d1ulje1, d1uljf_ complexed with bnl, fe2, fes |
PDB Entry: 1ulj (more details), 2.6 Å
SCOPe Domain Sequences for d1ulje2:
Sequence, based on SEQRES records: (download)
>d1ulje2 d.129.3.3 (E:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. RHA1 [TaxId: 101510]} apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh lsgilaglpdgvdlselapptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqg paaekaserlgstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvda dapeemkeeyrqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtds dnpdypgtisyvyseeaarglytqwvrmmtspdwaaldatr
>d1ulje2 d.129.3.3 (E:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. RHA1 [TaxId: 101510]} apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh lsgilaglptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqgpaaekaserlg stergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvdadapeemkeeyr qqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtdsdnpdypgtisy vyseeaarglytqwvrmmtspdwaaldatr
Timeline for d1ulje2: