Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.129: TBP-like [55944] (9 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (6 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (2 proteins) Pfam 00848; contains a few insertion and C-terminal extension compared with Bet v1 |
Protein Biphenyl dioxygenase large subunit BphA1, C-terminal domain [111166] (1 species) |
Species Rhodococcus sp. strain RHA1 [TaxId:101510] [111167] (2 PDB entries) |
Domain d1uljc2: 1ulj C:171-451 [107934] Other proteins in same PDB: d1ulja1, d1uljb_, d1uljc1, d1uljd_, d1ulje1, d1uljf_ |
PDB Entry: 1ulj (more details), 2.6 Å
SCOP Domain Sequences for d1uljc2:
Sequence, based on SEQRES records: (download)
>d1uljc2 d.129.3.3 (C:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. strain RHA1} apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh lsgilaglpdgvdlselapptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqg paaekaserlgstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvda dapeemkeeyrqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtds dnpdypgtisyvyseeaarglytqwvrmmtspdwaaldatr
>d1uljc2 d.129.3.3 (C:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. strain RHA1} apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh lsgilagltegiqyratwgghgsgfyigdpnlllaimgpkvteywtqgpaaekaserlgs tergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvdadapeemkeeyrq qtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtdsdnpdypgtisyv yseeaarglytqwvrmmtspdwaaldatr
Timeline for d1uljc2: