Lineage for d1uljb_ (1ulj B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718985Superfamily d.17.4: NTF2-like [54427] (13 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 719127Family d.17.4.4: Ring hydroxylating beta subunit [54438] (4 proteins)
    Pfam PF00866
  6. 719128Protein Biphenyl dioxygenase small subunit BphA2 [110824] (1 species)
  7. 719129Species Rhodococcus sp. (strain RHA1) [TaxId:101510] [110825] (2 PDB entries)
  8. 719133Domain d1uljb_: 1ulj B: [107932]
    Other proteins in same PDB: d1ulja1, d1ulja2, d1uljc1, d1uljc2, d1ulje1, d1ulje2

Details for d1uljb_

PDB Entry: 1ulj (more details), 2.6 Å

PDB Description: Biphenyl dioxygenase (BphA1A2) in complex with the substrate
PDB Compounds: (B:) biphenyl dioxygenase small subunit

SCOP Domain Sequences for d1uljb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uljb_ d.17.4.4 (B:) Biphenyl dioxygenase small subunit BphA2 {Rhodococcus sp. (strain RHA1) [TaxId: 101510]}
frtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpirttrimretaq
eysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivdgekpgeyhvs
svfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstilsnnlsfff

SCOP Domain Coordinates for d1uljb_:

Click to download the PDB-style file with coordinates for d1uljb_.
(The format of our PDB-style files is described here.)

Timeline for d1uljb_: