Lineage for d1ulja2 (1ulj A:171-451)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. Protein Biphenyl dioxygenase large subunit BphA1, C-terminal domain [111166] (1 species)
  7. Species Rhodococcus sp. RHA1 [TaxId:101510] [111167] (2 PDB entries)
    Uniprot Q53122 17-451
  8. Domain d1ulja2: 1ulj A:171-451 [107931]
    Other proteins in same PDB: d1ulja1, d1uljb_, d1uljc1, d1uljd_, d1ulje1, d1uljf_
    complexed with bnl, fe2, fes

Details for d1ulja2

PDB Entry: 1ulj (more details), 2.6 Å

PDB Description: Biphenyl dioxygenase (BphA1A2) in complex with the substrate
PDB Compounds: (A:) biphenyl dioxygenase large subunit

SCOPe Domain Sequences for d1ulja2:

Sequence, based on SEQRES records: (download)

>d1ulja2 d.129.3.3 (A:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. RHA1 [TaxId: 101510]}
apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh
lsgilaglpdgvdlselapptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqg
paaekaserlgstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvda
dapeemkeeyrqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtds
dnpdypgtisyvyseeaarglytqwvrmmtspdwaaldatr

Sequence, based on observed residues (ATOM records): (download)

>d1ulja2 d.129.3.3 (A:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. RHA1 [TaxId: 101510]}
apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh
lsgilaglpptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqgpaaekaserl
gstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvdadapeemkeey
rqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtdsdnpdypgtis
yvyseeaarglytqwvrmmtspdwaaldatr

SCOPe Domain Coordinates for d1ulja2 are not available.

Timeline for d1ulja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ulja1
View in 3D
Domains from other chains:
(mouse over for more information)
d1uljb_, d1uljc1, d1uljc2, d1uljd_, d1ulje1, d1ulje2, d1uljf_