Lineage for d1ulja1 (1ulj A:17-170)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782956Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1782957Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1783075Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 1783096Protein Biphenyl dioxygenase large subunit BphA1, N-terminal domain [110156] (1 species)
  7. 1783097Species Rhodococcus sp. RHA1 [TaxId:101510] [110157] (2 PDB entries)
    Uniprot Q53122 17-451
  8. 1783101Domain d1ulja1: 1ulj A:17-170 [107930]
    Other proteins in same PDB: d1ulja2, d1uljb_, d1uljc2, d1uljd_, d1ulje2, d1uljf_
    complexed with bnl, fe2, fes

Details for d1ulja1

PDB Entry: 1ulj (more details), 2.6 Å

PDB Description: Biphenyl dioxygenase (BphA1A2) in complex with the substrate
PDB Compounds: (A:) biphenyl dioxygenase large subunit

SCOPe Domain Sequences for d1ulja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulja1 b.33.1.2 (A:17-170) Biphenyl dioxygenase large subunit BphA1, N-terminal domain {Rhodococcus sp. RHA1 [TaxId: 101510]}
wadadiaelvdertgrldpriytdealyeqelerifgrswllmghetqipkagdfmtnym
gedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsyhgwaydtggnlvsvpf
eeqafpglrkedwgplqarvetykglifanwdad

SCOPe Domain Coordinates for d1ulja1:

Click to download the PDB-style file with coordinates for d1ulja1.
(The format of our PDB-style files is described here.)

Timeline for d1ulja1: