Lineage for d1ulid_ (1uli D:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 500605Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 500831Superfamily d.17.4: NTF2-like [54427] (12 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 500956Family d.17.4.4: Ring hydroxylating beta subunit (Pfam 00866) [54438] (2 proteins)
  6. 500957Protein Biphenyl dioxygenase small subunit BphA2 [110824] (1 species)
  7. 500958Species Rhodococcus sp. strain RHA1 [TaxId:101510] [110825] (2 PDB entries)
  8. 500960Domain d1ulid_: 1uli D: [107926]
    Other proteins in same PDB: d1ulia1, d1ulia2, d1ulic1, d1ulic2, d1ulie1, d1ulie2

Details for d1ulid_

PDB Entry: 1uli (more details), 2.2 Å

PDB Description: Biphenyl dioxygenase (BphA1A2) derived from Rhodococcus sp. strain RHA1

SCOP Domain Sequences for d1ulid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulid_ d.17.4.4 (D:) Biphenyl dioxygenase small subunit BphA2 {Rhodococcus sp. strain RHA1}
afrtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpirttrimreta
qeysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivdgekpgeyhv
ssvfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstilsnnlsfff

SCOP Domain Coordinates for d1ulid_:

Click to download the PDB-style file with coordinates for d1ulid_.
(The format of our PDB-style files is described here.)

Timeline for d1ulid_: