Lineage for d1ulia2 (1uli A:171-451)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510905Fold d.129: TBP-like [55944] (8 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 511069Superfamily d.129.3: Bet v1-like [55961] (5 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 511112Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain (Pfam 00848) [55969] (2 proteins)
    contains a few insertion and C-terminal extension compared with Bet v1
  6. 511113Protein Biphenyl dioxygenase large subunit BphA1, C-terminal domain [111166] (1 species)
  7. 511114Species Rhodococcus sp. strain RHA1 [TaxId:101510] [111167] (2 PDB entries)
  8. 511115Domain d1ulia2: 1uli A:171-451 [107922]
    Other proteins in same PDB: d1ulia1, d1ulib_, d1ulic1, d1ulid_, d1ulie1, d1ulif_

Details for d1ulia2

PDB Entry: 1uli (more details), 2.2 Å

PDB Description: Biphenyl dioxygenase (BphA1A2) derived from Rhodococcus sp. strain RHA1

SCOP Domain Sequences for d1ulia2:

Sequence, based on SEQRES records: (download)

>d1ulia2 d.129.3.3 (A:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. strain RHA1}
apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh
lsgilaglpdgvdlselapptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqg
paaekaserlgstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvda
dapeemkeeyrqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtds
dnpdypgtisyvyseeaarglytqwvrmmtspdwaaldatr

Sequence, based on observed residues (ATOM records): (download)

>d1ulia2 d.129.3.3 (A:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. strain RHA1}
apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh
lsgilaglptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqgpaaekaserlg
stergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvdadapeemkeeyr
qqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtdsdnpdypgtisy
vyseeaarglytqwvrmmtspdwaaldatr

SCOP Domain Coordinates for d1ulia2:

Click to download the PDB-style file with coordinates for d1ulia2.
(The format of our PDB-style files is described here.)

Timeline for d1ulia2: