Lineage for d1ukxa1 (1ukx A:9-131)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2508113Family d.20.1.3: RWD domain [110843] (4 proteins)
    Pfam PF05773
  6. 2508118Protein EIF2-alpha kinase 4 (GCN2-like protein) [110844] (1 species)
  7. 2508119Species Mouse (Mus musculus) [TaxId:10090] [110845] (1 PDB entry)
    Uniprot Q9QZ05 17-139
  8. 2508120Domain d1ukxa1: 1ukx A:9-131 [107919]
    Other proteins in same PDB: d1ukxa2, d1ukxa3
    Structural genomics target

Details for d1ukxa1

PDB Entry: 1ukx (more details)

PDB Description: Solution structure of the RWD domain of mouse GCN2
PDB Compounds: (A:) GCN2 eIF2alpha kinase

SCOPe Domain Sequences for d1ukxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukxa1 d.20.1.3 (A:9-131) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]}
esysqrqdhelqaleaiygsdfqdlrpdargrvreppeinlvlypqglageevyvqvelr
vkcpptypdvvpeidlknakglsnesvnllkshleelakkqcgevmifelahhvqsflse
hnk

SCOPe Domain Coordinates for d1ukxa1:

Click to download the PDB-style file with coordinates for d1ukxa1.
(The format of our PDB-style files is described here.)

Timeline for d1ukxa1: