Lineage for d1ukvy_ (1ukv Y:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1594811Protein GTPase Ytp1 [110544] (1 species)
  7. 1594812Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110545] (2 PDB entries)
    Uniprot P01123
  8. 1594814Domain d1ukvy_: 1ukv Y: [107918]
    Other proteins in same PDB: d1ukvg1, d1ukvg2, d1ukvg3
    complexed with gdp, ger, mg

Details for d1ukvy_

PDB Entry: 1ukv (more details), 1.5 Å

PDB Description: Structure of RabGDP-dissociation inhibitor in complex with prenylated YPT1 GTPase
PDB Compounds: (Y:) GTP-binding protein YPT1

SCOPe Domain Sequences for d1ukvy_:

Sequence, based on SEQRES records: (download)

>d1ukvy_ c.37.1.8 (Y:) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiw
dtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnk
cdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlnett
qkkedkgnvnlkgqsltntgggcc

Sequence, based on observed residues (ATOM records): (download)

>d1ukvy_ c.37.1.8 (Y:) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiw
dtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnk
cdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlnett
qkkedkgnvnlkgqslc

SCOPe Domain Coordinates for d1ukvy_:

Click to download the PDB-style file with coordinates for d1ukvy_.
(The format of our PDB-style files is described here.)

Timeline for d1ukvy_: