Lineage for d1ukvg2 (1ukv G:400-446)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 478897Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 478898Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 479144Family c.3.1.3: GDI-like N domain [51931] (2 proteins)
    Similar to FAD-linked reductases in both domains but does not bind FAD
  6. 479145Protein Guanine nucleotide dissociation inhibitor, GDI [51932] (2 species)
    the inhibition function is probably associated with an insert subdomain, residues 120-220
  7. 479146Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110439] (1 PDB entry)
  8. 479148Domain d1ukvg2: 1ukv G:400-446 [107916]
    Other proteins in same PDB: d1ukvg3, d1ukvy_

Details for d1ukvg2

PDB Entry: 1ukv (more details), 1.5 Å

PDB Description: Structure of RabGDP-dissociation inhibitor in complex with prenylated YPT1 GTPase

SCOP Domain Sequences for d1ukvg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukvg2 c.3.1.3 (G:400-446) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae)}
predgskdniylsrsydasshfesmtddvkdiyfrvtghplvlkqrq

SCOP Domain Coordinates for d1ukvg2:

Click to download the PDB-style file with coordinates for d1ukvg2.
(The format of our PDB-style files is described here.)

Timeline for d1ukvg2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ukvy_