SCOPe 2.04: Domain d1ukvg1: 1ukv G:5-301

Lineage for d1ukvg1 (1ukv G:5-301)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.3: GDI-like N domain [51931] (3 proteins)
   Similar to FAD-linked reductases in both domains but does not bind FAD

6. Protein Guanine nucleotide dissociation inhibitor, GDI [51932] (2 species)
   the inhibition function is probably associated with an insert subdomain, residues 120-220

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110439] (2 PDB entries)
   Uniprot P39958 5-446

8. Domain d1ukvg1: 1ukv G:5-301 [107915]
   Other proteins in same PDB: d1ukvg3, d1ukvy_
   complexed with gdp, ger, mg

Details for d1ukvg1

PDB Entry: 1ukv, 1.5 Å

PDB Description: Structure of RabGDP-dissociation inhibitor in complex with prenylated YPT1 GTPase

PDB Compounds: (G:) Secretory pathway GDP dissociation inhibitor

SCOPe Domain Sequences for d1ukvg1:

Sequence; same for both SEQRES and ATOM records:

>d1ukvg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tidtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlyekfkqnp
iskeereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfkqgki
ykvpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmdevyykfg
lgnstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyglgelpq
gfarlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfpekc

Timeline for d1ukvg1:

• d1ukvg1 first appeared in SCOP 1.69
  
• d1ukvg1 appears in SCOPe 2.03
  
• d1ukvg1 appears in SCOPe 2.05
  
• d1ukvg1 appears in the current release, SCOPe 2.08