Lineage for d1ukha_ (1ukh A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544481Protein Mitogen-activated protein kinase 8 (jnk1) [111202] (1 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2544482Species Human (Homo sapiens) [TaxId:9606] [111203] (2 PDB entries)
    Uniprot P45983 9-363
  8. 2544483Domain d1ukha_: 1ukh A: [107913]

Details for d1ukha_

PDB Entry: 1ukh (more details), 2.35 Å

PDB Description: Structural basis for the selective inhibition of JNK1 by the scaffolding protein JIP1 and SP600125
PDB Compounds: (A:) mitogen-activated protein kinase 8 isoform 4

SCOPe Domain Sequences for d1ukha_:

Sequence, based on SEQRES records: (download)

>d1ukha_ d.144.1.7 (A:) Mitogen-activated protein kinase 8 (jnk1) {Human (Homo sapiens) [TaxId: 9606]}
nfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrpfqnqthak
rayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviqmeldherm
syllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyvvt
ryyrapevilgmgykenvdiwsvgcimgemikggvlfpgtdhidqwnkvieqlgtpcpef
mkklqptvrtyvenrpkyagysfeklfpdvlfpadsehnklkasqardllskmlvidask
risvdealqhpyinvwydpseaeapppkipdkqlderehtieewkeliykevmdl

Sequence, based on observed residues (ATOM records): (download)

>d1ukha_ d.144.1.7 (A:) Mitogen-activated protein kinase 8 (jnk1) {Human (Homo sapiens) [TaxId: 9606]}
nfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrpfqnqthak
rayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviqmeldherm
syllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglyyrapevilgmgyken
vdiwsvgcimgemikggvlfpgtdhidqwnkvieqlgtpcpefmkklqptvrtyvenrpk
yagysfeklfpdvlfpnklkasqardllskmlvidaskrisvdealqhpyinvwydpsea
eapppkieewkeliykevmdl

SCOPe Domain Coordinates for d1ukha_:

Click to download the PDB-style file with coordinates for d1ukha_.
(The format of our PDB-style files is described here.)

Timeline for d1ukha_: