Lineage for d1ukcb_ (1ukc B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135098Family c.69.1.17: Fungal lipases [53558] (5 protein domains)
  6. 2135099Protein Esterase EstA [110697] (1 species)
  7. 2135100Species Aspergillus niger [TaxId:5061] [110698] (1 PDB entry)
    Uniprot Q6ED33
  8. 2135102Domain d1ukcb_: 1ukc B: [107912]
    complexed with cl, edo, man, nag, so4

Details for d1ukcb_

PDB Entry: 1ukc (more details), 2.1 Å

PDB Description: Crystal Structure of Aspergillus niger EstA
PDB Compounds: (B:) EstA

SCOPe Domain Sequences for d1ukcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukcb_ c.69.1.17 (B:) Esterase EstA {Aspergillus niger [TaxId: 5061]}
qpvinlgyaryqgvrleagvdeflgmryasppigdlrfrapqdppanqtlqsateygpic
igldeeespgdisedclfinvfkpstatsqsklpvwlfiqgggyaensnanyngtqviqa
sddvivfvtfnyrvgalgflasekvrqngdlnaglldqrkalrwvkqyieqfggdpdhiv
ihgvsagagsvayhlsayggkdeglfigaivessfwptqrtvsemefqferfvndtgcss
ardsleclreqdiatiqkgntgspfpggsssplpdwyflpvtdgslvpdelynafdagnf
ikvpvlvgddtdegsnfaynasssadvsrffknnypnltsqqlneinqvyprgkllprha
ayfgassaaygdatftcpgnhvassaarylpnsvwnyrvniidesniaggigvphtfelp
aifgagstgtlssdssyltynaaiipvtmhyfisfvqtlnpntyryatapewntwgngqr
lrlqtndtameavpesslqdcafwksltvpmev

SCOPe Domain Coordinates for d1ukcb_:

Click to download the PDB-style file with coordinates for d1ukcb_.
(The format of our PDB-style files is described here.)

Timeline for d1ukcb_: