Lineage for d1uk8a_ (1uk8 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 491701Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 491702Superfamily c.69.1: alpha/beta-Hydrolases [53474] (32 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 491975Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins)
    closely related to the Proline iminopeptidase-like family
  6. 491982Protein Meta-cleavage product hydrolase CumD [82507] (1 species)
    2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
  7. 491983Species Pseudomonas fluorescens [TaxId:294] [82508] (9 PDB entries)
  8. 491984Domain d1uk8a_: 1uk8 A: [107907]

Details for d1uk8a_

PDB Entry: 1uk8 (more details), 1.6 Å

PDB Description: crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-valerate

SCOP Domain Sequences for d1uk8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens}
nleigksilaagvltnyhdvgegqpvilihgsgpgvsayanwrltipalskfyrviapdm
vgfgftdrpenynyskdswvdhiigimdaleiekahivgnafggglaiatalryservdr
mvlmgaagtrfdvteglnavwgytpsienmrnlldifaydrslvtdelarlryeasiqpg
fqesfssmfpeprqrwidalassdediktlpnetliihgredqvvplssslrlgelidra
qlhvfgrcghwtqieqtdrfnrlvveffnea

SCOP Domain Coordinates for d1uk8a_:

Click to download the PDB-style file with coordinates for d1uk8a_.
(The format of our PDB-style files is described here.)

Timeline for d1uk8a_: