Lineage for d1uk6a_ (1uk6 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2507968Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins)
    closely related to the Proline iminopeptidase-like family
  6. 2507992Protein Meta-cleavage product hydrolase CumD [82507] (1 species)
    2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
  7. 2507993Species Pseudomonas fluorescens [TaxId:294] [82508] (10 PDB entries)
    Uniprot P96965 3-273
  8. 2508001Domain d1uk6a_: 1uk6 A: [107905]
    complexed with ppi

Details for d1uk6a_

PDB Entry: 1uk6 (more details), 1.95 Å

PDB Description: crystal structure of a meta-cleavage product hydrolase (cumd) complexed with propionate
PDB Compounds: (A:) 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase

SCOPe Domain Sequences for d1uk6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uk6a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}
nleigksilaagvltnyhdvgegqpvilihgsgpgvsayanwrltipalskfyrviapdm
vgfgftdrpenynyskdswvdhiigimdaleiekahivgnafggglaiatalryservdr
mvlmgaagtrfdvteglnavwgytpsienmrnlldifaydrslvtdelarlryeasiqpg
fqesfssmfpeprqrwidalassdediktlpnetliihgredqvvplssslrlgelidra
qlhvfgrcghwtqieqtdrfnrlvveffnea

SCOPe Domain Coordinates for d1uk6a_:

Click to download the PDB-style file with coordinates for d1uk6a_.
(The format of our PDB-style files is described here.)

Timeline for d1uk6a_: