Lineage for d1uk1b2 (1uk1 B:799-1011)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514038Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 514039Superfamily d.166.1: ADP-ribosylation [56399] (4 families) (S)
  5. 514145Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (1 protein)
  6. 514146Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)
  7. 514155Species Human (Homo sapiens) [TaxId:9606] [103339] (2 PDB entries)
  8. 514157Domain d1uk1b2: 1uk1 B:799-1011 [107904]
    Other proteins in same PDB: d1uk1a1, d1uk1b1

Details for d1uk1b2

PDB Entry: 1uk1 (more details), 3 Å

PDB Description: Crystal structure of human poly(ADP-ribose) polymerase complexed with a potent inhibitor

SCOP Domain Sequences for d1uk1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uk1b2 d.166.1.2 (B:799-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Human (Homo sapiens)}
tdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhnrr
llwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpigl
illgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgissg
vndtsllyneyivydiaqvnlkyllklkfnfkt

SCOP Domain Coordinates for d1uk1b2:

Click to download the PDB-style file with coordinates for d1uk1b2.
(The format of our PDB-style files is described here.)

Timeline for d1uk1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uk1b1