Lineage for d1uk1b2 (1uk1 B:799-1011)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000666Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 3000667Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)
  7. 3000676Species Human (Homo sapiens) [TaxId:9606] [103339] (8 PDB entries)
    Uniprot P09874 661-1010
  8. 3000684Domain d1uk1b2: 1uk1 B:799-1011 [107904]
    Other proteins in same PDB: d1uk1a1, d1uk1b1
    complexed with frq

Details for d1uk1b2

PDB Entry: 1uk1 (more details), 3 Å

PDB Description: Crystal structure of human poly(ADP-ribose) polymerase complexed with a potent inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase-1

SCOPe Domain Sequences for d1uk1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uk1b2 d.166.1.2 (B:799-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhnrr
llwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpigl
illgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgissg
vndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d1uk1b2:

Click to download the PDB-style file with coordinates for d1uk1b2.
(The format of our PDB-style files is described here.)

Timeline for d1uk1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uk1b1