Lineage for d1uk1b1 (1uk1 B:662-798)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443245Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 443246Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (1 family) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
  5. 443247Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)
  6. 443248Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)
  7. 443257Species Human (Homo sapiens) [TaxId:9606] [101198] (2 PDB entries)
  8. 443259Domain d1uk1b1: 1uk1 B:662-798 [107903]
    Other proteins in same PDB: d1uk1a2, d1uk1b2

Details for d1uk1b1

PDB Entry: 1uk1 (more details), 3 Å

PDB Description: Crystal structure of human poly(ADP-ribose) polymerase complexed with a potent inhibitor

SCOP Domain Sequences for d1uk1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uk1b1 a.41.1.1 (B:662-798) Domain of poly(ADP-ribose) polymerase {Human (Homo sapiens)}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
sddsskdpidvnyeklk

SCOP Domain Coordinates for d1uk1b1:

Click to download the PDB-style file with coordinates for d1uk1b1.
(The format of our PDB-style files is described here.)

Timeline for d1uk1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uk1b2