Lineage for d1ujoa_ (1ujo A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538206Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 538207Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family) (S)
  5. 538208Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (9 proteins)
    Pfam 00307
  6. 538258Protein Transgelin [109830] (1 species)
  7. 538259Species Mouse (Mus musculus) [TaxId:10090] [109831] (1 PDB entry)
  8. 538260Domain d1ujoa_: 1ujo A: [107900]
    Structural genomics target

Details for d1ujoa_

PDB Entry: 1ujo (more details)

PDB Description: solution structure of the ch domain from mouse trangelin

SCOP Domain Sequences for d1ujoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus)}
gssgssgeeleerlvewivvqcgpdvgrpdrgrlgfqvwlkngvilsklvnslypegskp
vkvpenppsmvfkqmeqvaqflkaaedygviktdmfqtvdlyegkdmaavqrtlmalgsl
avtkndgnyrgdpnwfmksgpssg

SCOP Domain Coordinates for d1ujoa_:

Click to download the PDB-style file with coordinates for d1ujoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ujoa_: