Lineage for d1ujoa1 (1ujo A:8-138)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712024Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2712077Protein Transgelin [109830] (1 species)
  7. 2712078Species Mouse (Mus musculus) [TaxId:10090] [109831] (1 PDB entry)
    Uniprot P37804 23-153
  8. 2712079Domain d1ujoa1: 1ujo A:8-138 [107900]
    Other proteins in same PDB: d1ujoa2, d1ujoa3
    Structural genomics target

Details for d1ujoa1

PDB Entry: 1ujo (more details)

PDB Description: solution structure of the ch domain from mouse trangelin
PDB Compounds: (A:) Transgelin

SCOPe Domain Sequences for d1ujoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujoa1 a.40.1.1 (A:8-138) Transgelin {Mouse (Mus musculus) [TaxId: 10090]}
eeleerlvewivvqcgpdvgrpdrgrlgfqvwlkngvilsklvnslypegskpvkvpenp
psmvfkqmeqvaqflkaaedygviktdmfqtvdlyegkdmaavqrtlmalgslavtkndg
nyrgdpnwfmk

SCOPe Domain Coordinates for d1ujoa1:

Click to download the PDB-style file with coordinates for d1ujoa1.
(The format of our PDB-style files is described here.)

Timeline for d1ujoa1: