Lineage for d1uj6a2 (1uj6 A:132-205)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505583Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) (S)
  5. 505584Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein)
  6. 505585Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (4 species)
  7. 505605Species Thermus thermophilus [TaxId:274] [110984] (3 PDB entries)
  8. 505606Domain d1uj6a2: 1uj6 A:132-205 [107899]
    Other proteins in same PDB: d1uj6a1

Details for d1uj6a2

PDB Entry: 1uj6 (more details), 1.74 Å

PDB Description: Crystal structure of Thermus thermophilus ribose-5-phosphate isomerase complexed with arabinose-5-phosphate

SCOP Domain Sequences for d1uj6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uj6a2 d.58.40.1 (A:132-205) D-ribose-5-phosphate isomerase (RpiA), lid domain {Thermus thermophilus}
grgpvpveivpfgyratlkaiadlggepelrmdgdefyftdgghliadcrfgpigdplgl
hralleipgvvetg

SCOP Domain Coordinates for d1uj6a2:

Click to download the PDB-style file with coordinates for d1uj6a2.
(The format of our PDB-style files is described here.)

Timeline for d1uj6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uj6a1