Lineage for d1uj6a2 (1uj6 A:132-205)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2522342Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) (S)
  5. 2522343Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein)
  6. 2522344Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (4 species)
  7. 2522364Species Thermus thermophilus [TaxId:274] [110984] (3 PDB entries)
    Uniprot Q72J47
  8. 2522365Domain d1uj6a2: 1uj6 A:132-205 [107899]
    Other proteins in same PDB: d1uj6a1
    complexed with a5p, cl

Details for d1uj6a2

PDB Entry: 1uj6 (more details), 1.74 Å

PDB Description: Crystal structure of Thermus thermophilus ribose-5-phosphate isomerase complexed with arabinose-5-phosphate
PDB Compounds: (A:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d1uj6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uj6a2 d.58.40.1 (A:132-205) D-ribose-5-phosphate isomerase (RpiA), lid domain {Thermus thermophilus [TaxId: 274]}
grgpvpveivpfgyratlkaiadlggepelrmdgdefyftdgghliadcrfgpigdplgl
hralleipgvvetg

SCOPe Domain Coordinates for d1uj6a2:

Click to download the PDB-style file with coordinates for d1uj6a2.
(The format of our PDB-style files is described here.)

Timeline for d1uj6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uj6a1