![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) ![]() |
![]() | Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein) |
![]() | Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [110984] (3 PDB entries) Uniprot Q72J47 |
![]() | Domain d1uj6a2: 1uj6 A:132-205 [107899] Other proteins in same PDB: d1uj6a1 complexed with a5p, cl |
PDB Entry: 1uj6 (more details), 1.74 Å
SCOPe Domain Sequences for d1uj6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uj6a2 d.58.40.1 (A:132-205) D-ribose-5-phosphate isomerase (RpiA), lid domain {Thermus thermophilus [TaxId: 274]} grgpvpveivpfgyratlkaiadlggepelrmdgdefyftdgghliadcrfgpigdplgl hralleipgvvetg
Timeline for d1uj6a2: