SCOPe 2.07: Domain d1uj5a2: 1uj5 A:132-205

Lineage for d1uj5a2 (1uj5 A:132-205)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family)

5. Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein)

6. Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (4 species)

7. Species Thermus thermophilus [TaxId:274] [110984] (3 PDB entries)
   Uniprot Q72J47

8. Domain d1uj5a2: 1uj5 A:132-205 [107897]
   Other proteins in same PDB: d1uj5a1
   complexed with 5rp, cl

Details for d1uj5a2

PDB Entry: 1uj5, 2 Å

PDB Description: Crystal structure of Thermus thermophilus ribose-5-phosphate isomerase complexed with ribose-5-phosphate

PDB Compounds: (A:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d1uj5a2:

Sequence; same for both SEQRES and ATOM records:

>d1uj5a2 d.58.40.1 (A:132-205) D-ribose-5-phosphate isomerase (RpiA), lid domain {Thermus thermophilus [TaxId: 274]}
grgpvpveivpfgyratlkaiadlggepelrmdgdefyftdgghliadcrfgpigdplgl
hralleipgvvetg

Timeline for d1uj5a2:

• d1uj5a2 first appeared in SCOP 1.69
  
• d1uj5a2 appears in SCOPe 2.06
  
• d1uj5a2 appears in the current release, SCOPe 2.08