Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) |
Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein) |
Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (4 species) |
Species Thermus thermophilus [TaxId:274] [110984] (3 PDB entries) Uniprot Q72J47 |
Domain d1uj5a2: 1uj5 A:132-205 [107897] Other proteins in same PDB: d1uj5a1 complexed with 5rp, cl |
PDB Entry: 1uj5 (more details), 2 Å
SCOPe Domain Sequences for d1uj5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uj5a2 d.58.40.1 (A:132-205) D-ribose-5-phosphate isomerase (RpiA), lid domain {Thermus thermophilus [TaxId: 274]} grgpvpveivpfgyratlkaiadlggepelrmdgdefyftdgghliadcrfgpigdplgl hralleipgvvetg
Timeline for d1uj5a2: