Lineage for d1uj4a2 (1uj4 A:132-205)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) 
Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein) Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (4 species) 
Species Thermus thermophilus [TaxId:274] [110984] (3 PDB entries) 
Domain d1uj4a2: 1uj4 A:132-205 [107895]
Other proteins in same PDB: d1uj4a1
Details for d1uj4a2
PDB Entry: 1uj4 (more details), 1.8 Å
PDB Description: Crystal structure of Thermus thermophilus ribose-5-phosphate isomerase
SCOP Domain Sequences for d1uj4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uj4a2 d.58.40.1 (A:132-205) D-ribose-5-phosphate isomerase (RpiA), lid domain {Thermus thermophilus}
grgpvpveivpfgyratlkaiadlggepelrmdgdefyftdgghliadcrfgpigdplgl
hralleipgvvetg
SCOP Domain Coordinates for d1uj4a2:
Click to download the PDB-style file with coordinates for d1uj4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uj4a2:
- d1uj4a2 is new in SCOP 1.69
- d1uj4a2 appears in SCOP 1.71
- d1uj4a2 appears in the current release, SCOPe 2.08
View in 3D
