Lineage for d1uj3c2 (1uj3 C:707-810)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 454980Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 454981Family b.1.2.1: Fibronectin type III [49266] (24 proteins)
  6. 455036Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 455037Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)
  8. 455061Domain d1uj3c2: 1uj3 C:707-810 [107893]
    Other proteins in same PDB: d1uj3a1, d1uj3a2, d1uj3b1, d1uj3b2

Details for d1uj3c2

PDB Entry: 1uj3 (more details), 2.1 Å

PDB Description: crystal structure of a humanized fab fragment of anti-tissue-factor antibody in complex with tissue factor

SCOP Domain Sequences for d1uj3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uj3c2 b.1.2.1 (C:707-810) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

SCOP Domain Coordinates for d1uj3c2:

Click to download the PDB-style file with coordinates for d1uj3c2.
(The format of our PDB-style files is described here.)

Timeline for d1uj3c2: