Lineage for d1uj3c1 (1uj3 C:606-706)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2035677Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2035780Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2035781Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
    Uniprot P13726 33-242
  8. 2035851Domain d1uj3c1: 1uj3 C:606-706 [107892]
    Other proteins in same PDB: d1uj3a1, d1uj3a2, d1uj3b1, d1uj3b2

Details for d1uj3c1

PDB Entry: 1uj3 (more details), 2.1 Å

PDB Description: crystal structure of a humanized fab fragment of anti-tissue-factor antibody in complex with tissue factor
PDB Compounds: (C:) tissue factor

SCOPe Domain Sequences for d1uj3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uj3c1 b.1.2.1 (C:606-706) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

SCOPe Domain Coordinates for d1uj3c1:

Click to download the PDB-style file with coordinates for d1uj3c1.
(The format of our PDB-style files is described here.)

Timeline for d1uj3c1: