Lineage for d1uj3b2 (1uj3 B:418-517)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2022294Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 2022298Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2022604Domain d1uj3b2: 1uj3 B:418-517 [107891]
    Other proteins in same PDB: d1uj3a1, d1uj3a2, d1uj3b1, d1uj3c1, d1uj3c2
    MQ NA P01857 # artificial chimera

Details for d1uj3b2

PDB Entry: 1uj3 (more details), 2.1 Å

PDB Description: Crystal structure of a humanized Fab fragment of anti-tissue-factor antibody in complex with tissue factor
PDB Compounds: (B:) IgG Fab heavy chain

SCOPe Domain Sequences for d1uj3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uj3b2 b.1.1.2 (B:418-517) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtktytcnvdhkpsntkvdkrves

SCOPe Domain Coordinates for d1uj3b2:

Click to download the PDB-style file with coordinates for d1uj3b2.
(The format of our PDB-style files is described here.)

Timeline for d1uj3b2: