Lineage for d1uj3a1 (1uj3 A:1-107)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2018294Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2018295Species Engineered (including hybrid species) [88533] (61 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 2018375Domain d1uj3a1: 1uj3 A:1-107 [107888]
    Other proteins in same PDB: d1uj3a2, d1uj3b1, d1uj3b2, d1uj3c1, d1uj3c2
    MQ NA P01834 # artificial chimera

Details for d1uj3a1

PDB Entry: 1uj3 (more details), 2.1 Å

PDB Description: Crystal structure of a humanized Fab fragment of anti-tissue-factor antibody in complex with tissue factor
PDB Compounds: (A:) IgG Fab light chain

SCOPe Domain Sequences for d1uj3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uj3a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitckasqdiksflswyqqkpekapksliyyatsladgvps
rfsgsgsgtdytltisslqpedfatyyclqhgespytfgggtkveik

SCOPe Domain Coordinates for d1uj3a1:

Click to download the PDB-style file with coordinates for d1uj3a1.
(The format of our PDB-style files is described here.)

Timeline for d1uj3a1: