![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (5 families) ![]() |
![]() | Family d.80.1.3: MIF-related [55339] (2 proteins) |
![]() | Protein Microphage migration inhibition factor (MIF) [55340] (5 species) synonym: glycosylation-inhibiting factor (GIF) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [111042] (1 PDB entry) |
![]() | Domain d1uizc_: 1uiz C: [107886] |
PDB Entry: 1uiz (more details), 2.5 Å
SCOP Domain Sequences for d1uizc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uizc_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {African clawed frog (Xenopus laevis)} mpvftirtnvcrdsvpdtllsdltkqlakatgkpaeyiaihivpdqimsfgdstdpcavc slcsigkiggpqnksytkllcdiltkqlnipanrvyinyydlnaanvgwngstfa
Timeline for d1uizc_: