Lineage for d1uizc_ (1uiz C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506749Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 506750Superfamily d.80.1: Tautomerase/MIF [55331] (5 families) (S)
  5. 506835Family d.80.1.3: MIF-related [55339] (2 proteins)
  6. 506841Protein Microphage migration inhibition factor (MIF) [55340] (5 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 506842Species African clawed frog (Xenopus laevis) [TaxId:8355] [111042] (1 PDB entry)
  8. 506845Domain d1uizc_: 1uiz C: [107886]

Details for d1uizc_

PDB Entry: 1uiz (more details), 2.5 Å

PDB Description: crystal structure of macrophage migration inhibitory factor from xenopus laevis.

SCOP Domain Sequences for d1uizc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uizc_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {African clawed frog (Xenopus laevis)}
mpvftirtnvcrdsvpdtllsdltkqlakatgkpaeyiaihivpdqimsfgdstdpcavc
slcsigkiggpqnksytkllcdiltkqlnipanrvyinyydlnaanvgwngstfa

SCOP Domain Coordinates for d1uizc_:

Click to download the PDB-style file with coordinates for d1uizc_.
(The format of our PDB-style files is described here.)

Timeline for d1uizc_: