Lineage for d1uiza_ (1uiz A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2526467Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2526468Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2526662Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. 2526679Protein Microphage migration inhibition factor (MIF) [55340] (8 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 2526680Species African clawed frog (Xenopus laevis) [TaxId:8355] [111042] (1 PDB entry)
    Uniprot Q76BK2
  8. 2526681Domain d1uiza_: 1uiz A: [107884]

Details for d1uiza_

PDB Entry: 1uiz (more details), 2.5 Å

PDB Description: crystal structure of macrophage migration inhibitory factor from xenopus laevis.
PDB Compounds: (A:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d1uiza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uiza_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mpvftirtnvcrdsvpdtllsdltkqlakatgkpaeyiaihivpdqimsfgdstdpcavc
slcsigkiggpqnksytkllcdiltkqlnipanrvyinyydlnaanvgwngstfa

SCOPe Domain Coordinates for d1uiza_:

Click to download the PDB-style file with coordinates for d1uiza_.
(The format of our PDB-style files is described here.)

Timeline for d1uiza_: