SCOP 1.69: Domain d1uikc2: 1uik C:351-535

Lineage for d1uikc2 (1uik C:351-535)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (13 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId:3847] [110313] (1 PDB entry)

8. Domain d1uikc2: 1uik C:351-535 [107883]

Details for d1uikc2

PDB Entry: 1uik, 2.3 Å

PDB Description: Crystal structure of soybean beta-conglycinin alpha prime homotrimer

SCOP Domain Sequences for d1uikc2:

Sequence, based on SEQRES records:

>d1uikc2 b.82.1.2 (C:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit}
ktissedkpfnlrsrdpiysnklgklfeitpeknpqlrdldvflsvvdmnegalflphfn
skaivvlvinegeanielvgikeqqqrqqqeeqplevrkyraelseqdifvipagypvvv
natsdlnffafginaennqrnflagskdnvisqipsqvqelafpgsakdienliksqses
yfvda

Sequence, based on observed residues (ATOM records):

>d1uikc2 b.82.1.2 (C:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit}
ktissedkpfnlrsrdpiysnklgklfeitpeknpqlrdldvflsvvdmnegalflphfn
skaivvlvinegeanielvgiplevrkyraelseqdifvipagypvvvnatsdlnffafg
inaennqrnflagskdnvisqipsqvqelafpgsakdienliksqsesyfvda

Timeline for d1uikc2:

• d1uikc2 is new in SCOP 1.69
  
• d1uikc2 appears in SCOP 1.71
  
• d1uikc2 appears in the current release, SCOPe 2.08