SCOPe 2.05: Domain d1uikb1: 1uik B:148-350

Lineage for d1uikb1 (1uik B:148-350)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId:3847] [110313] (1 PDB entry)
   Uniprot Q7XXT2 204-621

8. Domain d1uikb1: 1uik B:148-350 [107880]
   complexed with mg

Details for d1uikb1

PDB Entry: 1uik, 2.3 Å

PDB Description: Crystal structure of soybean beta-conglycinin alpha prime homotrimer

PDB Compounds: (B:) alpha prime subunit of beta-conglycinin

SCOPe Domain Sequences for d1uikb1:

Sequence, based on SEQRES records:

>d1uikb1 b.82.1.2 (B:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}
npfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlllphhada
dylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmitlaipv
nkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgreegqqqgeerlqe
sviveiskkqirelskhaksssr

Sequence, based on observed residues (ATOM records):

>d1uikb1 b.82.1.2 (B:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}
npfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlllphhada
dylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmitlaipv
nkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgqesviveiskkqir
elskhaksssr

Timeline for d1uikb1:

• d1uikb1 first appeared in SCOP 1.69
  
• d1uikb1 appears in SCOPe 2.04
  
• d1uikb1 appears in SCOPe 2.06
  
• d1uikb1 appears in the current release, SCOPe 2.08