Lineage for d1uikb1 (1uik B:148-350)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677316Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 677339Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 677374Species Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId:3847] [110313] (1 PDB entry)
  8. 677377Domain d1uikb1: 1uik B:148-350 [107880]

Details for d1uikb1

PDB Entry: 1uik (more details), 2.3 Å

PDB Description: Crystal structure of soybean beta-conglycinin alpha prime homotrimer
PDB Compounds: (B:) alpha prime subunit of beta-conglycinin

SCOP Domain Sequences for d1uikb1:

Sequence, based on SEQRES records: (download)

>d1uikb1 b.82.1.2 (B:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}
npfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlllphhada
dylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmitlaipv
nkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgreegqqqgeerlqe
sviveiskkqirelskhaksssr

Sequence, based on observed residues (ATOM records): (download)

>d1uikb1 b.82.1.2 (B:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]}
npfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlllphhada
dylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmitlaipv
nkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgqesviveiskkqir
elskhaksssr

SCOP Domain Coordinates for d1uikb1:

Click to download the PDB-style file with coordinates for d1uikb1.
(The format of our PDB-style files is described here.)

Timeline for d1uikb1: