Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Seed storage 7S protein [51188] (6 species) duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer |
Species Soybean (Glycine max), beta-conglycinin beta subunit [TaxId:3847] [109608] (3 PDB entries) Uniprot P25974 |
Domain d1uije2: 1uij E:183-392 [107875] |
PDB Entry: 1uij (more details), 2.5 Å
SCOPe Domain Sequences for d1uije2:
Sequence, based on SEQRES records: (download)
>d1uije2 b.82.1.2 (E:183-392) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp qlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeeepl evqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqie rqvqelafpgsaqdverllkkqresyfvda
>d1uije2 b.82.1.2 (E:183-392) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp qlrdldiflssvdinegalllphfnskaivilvinegdanielvgiklevqryraelsed dvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsa qdverllkkqresyfvda
Timeline for d1uije2: