Lineage for d1uije1 (1uij E:6-175)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814551Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2814575Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 2814631Species Soybean (Glycine max), beta-conglycinin beta subunit [TaxId:3847] [109608] (3 PDB entries)
    Uniprot P25974
  8. 2814640Domain d1uije1: 1uij E:6-175 [107874]

Details for d1uije1

PDB Entry: 1uij (more details), 2.5 Å

PDB Description: crystal structure of soybean beta-conglycinin beta homotrimer (i122m/k124w)
PDB Compounds: (E:) beta subunit of beta conglycinin

SCOPe Domain Sequences for d1uije1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uije1 b.82.1.2 (E:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]}
dennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillph
hadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmiwl
aipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfg

SCOPe Domain Coordinates for d1uije1:

Click to download the PDB-style file with coordinates for d1uije1.
(The format of our PDB-style files is described here.)

Timeline for d1uije1: