SCOP 1.71: Domain d1uijc2: 1uij C:183-392

Lineage for d1uijc2 (1uij C:183-392)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (16 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species beta-conglycinin beta subunit [109608] (3 PDB entries)

8. Domain d1uijc2: 1uij C:183-392 [107871]

Details for d1uijc2

PDB Entry: 1uij, 2.5 Å

PDB Description: crystal structure of soybean beta-conglycinin beta homotrimer (i122m/k124w)

SCOP Domain Sequences for d1uijc2:

Sequence, based on SEQRES records:

>d1uijc2 b.82.1.2 (C:183-392) Seed storage 7S protein {beta-conglycinin beta subunit}
qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp
qlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeeepl
evqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqie
rqvqelafpgsaqdverllkkqresyfvda

Sequence, based on observed residues (ATOM records):

>d1uijc2 b.82.1.2 (C:183-392) Seed storage 7S protein {beta-conglycinin beta subunit}
qegviveldepfnlrsrnpiysnnfgkffeitpeknpqlrdldiflssvdinegalllph
fnskaivilvinegdanielvgikplevqryraelseddvfvipaaypfvvnatsnlnfl
afginaennqrnflagekdnvvrqierqvqelafpgsaqdverllkkqresyfvda

Timeline for d1uijc2:

• d1uijc2 first appeared in SCOP 1.69
  
• d1uijc2 appears in SCOP 1.73
  
• d1uijc2 appears in the current release, SCOPe 2.08