Lineage for d1uijc1 (1uij C:6-175)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567256Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 567257Superfamily b.82.1: RmlC-like cupins [51182] (16 families) (S)
  5. 567289Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 567308Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 567309Species beta-conglycinin beta subunit [109608] (3 PDB entries)
  8. 567314Domain d1uijc1: 1uij C:6-175 [107870]

Details for d1uijc1

PDB Entry: 1uij (more details), 2.5 Å

PDB Description: crystal structure of soybean beta-conglycinin beta homotrimer (i122m/k124w)

SCOP Domain Sequences for d1uijc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uijc1 b.82.1.2 (C:6-175) Seed storage 7S protein {beta-conglycinin beta subunit}
dennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillph
hadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmiwl
aipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfg

SCOP Domain Coordinates for d1uijc1:

Click to download the PDB-style file with coordinates for d1uijc1.
(The format of our PDB-style files is described here.)

Timeline for d1uijc1: