Lineage for d1uiib_ (1uii B:)

  1. Root: SCOP 1.69
  2. 525081Class h: Coiled coil proteins [57942] (6 folds)
  3. 525082Fold h.1: Parallel coiled-coil [57943] (28 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 525897Superfamily h.1.28: Geminin coiled-coil domain [111469] (1 family) (S)
  5. 525898Family h.1.28.1: Geminin coiled-coil domain [111470] (1 protein)
  6. 525899Protein Geminin coiled-coil domain [111471] (2 species)
  7. 525900Species Human (Homo sapiens) [TaxId:9606] [111472] (2 PDB entries)
  8. 525904Domain d1uiib_: 1uii B: [107865]

Details for d1uiib_

PDB Entry: 1uii (more details), 2 Å

PDB Description: Crystal structure of Geminin coiled-coil domain

SCOP Domain Sequences for d1uiib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uiib_ h.1.28.1 (B:) Geminin coiled-coil domain {Human (Homo sapiens)}
enpssqywkevaekrrkalyealkeneklhkeieqkdneiarlkkenkelaevaehvqym
a

SCOP Domain Coordinates for d1uiib_:

Click to download the PDB-style file with coordinates for d1uiib_.
(The format of our PDB-style files is described here.)

Timeline for d1uiib_:

525904
d1uiib_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1uiia_