Lineage for d1ui6b2 (1ui6 B:80-212)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543325Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 543326Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 543327Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)
  6. 543328Protein A-factor receptor homolog CprB [109980] (1 species)
    gamma-butyrolactone receptor
  7. 543329Species Streptomyces coelicolor [TaxId:1902] [109981] (2 PDB entries)
  8. 543333Domain d1ui6b2: 1ui6 B:80-212 [107863]
    Other proteins in same PDB: d1ui6a1, d1ui6b1

Details for d1ui6b2

PDB Entry: 1ui6 (more details), 2.4 Å

PDB Description: Crystal structure of gamma-butyrolactone receptor (ArpA-like protein)

SCOP Domain Sequences for d1ui6b2:

Sequence, based on SEQRES records: (download)

>d1ui6b2 a.121.1.1 (B:80-212) A-factor receptor homolog CprB {Streptomyces coelicolor}
ysslealmrltfgmarlcvqgpvlraglrlatagvpvrpplphpftewreiatsrlldav
rqsdvhqdidvdsvahtlvcsvvgtrvvggtlepagreprrlaemwyilirgmvpvtrra
ryvtlaarleqet

Sequence, based on observed residues (ATOM records): (download)

>d1ui6b2 a.121.1.1 (B:80-212) A-factor receptor homolog CprB {Streptomyces coelicolor}
ysslealmrltfgmarlcvqgpvlraglrlatagvpvrpplphpftewreiatsrlldav
rqsdvhqdidvdsvahtlvcsvvreprrlaemwyilirgmvpvtrraryvtlaarleqet

SCOP Domain Coordinates for d1ui6b2:

Click to download the PDB-style file with coordinates for d1ui6b2.
(The format of our PDB-style files is described here.)

Timeline for d1ui6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ui6b1