Lineage for d1ui6a2 (1ui6 A:80-212)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008144Protein A-factor receptor homolog CprB [109980] (1 species)
    gamma-butyrolactone receptor
  7. 2008145Species Streptomyces coelicolor [TaxId:1902] [109981] (2 PDB entries)
    Uniprot O66122
  8. 2008148Domain d1ui6a2: 1ui6 A:80-212 [107861]
    Other proteins in same PDB: d1ui6a1, d1ui6b1

Details for d1ui6a2

PDB Entry: 1ui6 (more details), 2.4 Å

PDB Description: Crystal structure of gamma-butyrolactone receptor (ArpA-like protein)
PDB Compounds: (A:) A-factor receptor homolog

SCOPe Domain Sequences for d1ui6a2:

Sequence, based on SEQRES records: (download)

>d1ui6a2 a.121.1.1 (A:80-212) A-factor receptor homolog CprB {Streptomyces coelicolor [TaxId: 1902]}
ysslealmrltfgmarlcvqgpvlraglrlatagvpvrpplphpftewreiatsrlldav
rqsdvhqdidvdsvahtlvcsvvgtrvvggtlepagreprrlaemwyilirgmvpvtrra
ryvtlaarleqet

Sequence, based on observed residues (ATOM records): (download)

>d1ui6a2 a.121.1.1 (A:80-212) A-factor receptor homolog CprB {Streptomyces coelicolor [TaxId: 1902]}
ysslealmrltfgmarlcvqgpvlraglrlatagvpvrpplphpftewreiatsrlldav
rqsdvhqdidvdsvahtlvcsvvrlaemwyilirgmvpvtrraryvtlaarleqet

SCOPe Domain Coordinates for d1ui6a2:

Click to download the PDB-style file with coordinates for d1ui6a2.
(The format of our PDB-style files is described here.)

Timeline for d1ui6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ui6a1