Lineage for d1ui5b2 (1ui5 B:80-212)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. Protein A-factor receptor homolog CprB [109980] (1 species)
    gamma-butyrolactone receptor
  7. Species Streptomyces coelicolor [TaxId:1902] [109981] (2 PDB entries)
    Uniprot O66122
  8. Domain d1ui5b2: 1ui5 B:80-212 [107859]
    Other proteins in same PDB: d1ui5a1, d1ui5b1

Details for d1ui5b2

PDB Entry: 1ui5 (more details), 2.4 Å

PDB Description: Crystal structure of gamma-butyrolactone receptor (ArpA like protein)
PDB Compounds: (B:) A-factor receptor homolog

SCOPe Domain Sequences for d1ui5b2:

Sequence, based on SEQRES records: (download)

>d1ui5b2 a.121.1.1 (B:80-212) A-factor receptor homolog CprB {Streptomyces coelicolor [TaxId: 1902]}
ysslealmrltfgmarlcvqgpvlraglrlatagvpvrpplphpftewreiatsrlldav
rqsdvhqdidvdsvahtlvcsvvgtrvvggtlepagreprrlaemwyilirgmvpvtrra
ryvtlaarleqet

Sequence, based on observed residues (ATOM records): (download)

>d1ui5b2 a.121.1.1 (B:80-212) A-factor receptor homolog CprB {Streptomyces coelicolor [TaxId: 1902]}
ysslealmrltfgmarlcvqgpvlraglrlatagvpvrlphpftewreiatsrlldavrq
sdvhqdidvdsvahtlvcsvvgtrvvggtlepagreprrlaemwyilirgmvpvtrrary
vtlaarleqet

SCOPe Domain Coordinates for d1ui5b2 are not available.

Timeline for d1ui5b2:

Domains from same chain:
(mouse over for more information)
d1ui5b1
Domains from other chains:
(mouse over for more information)
d1ui5a1, d1ui5a2