Lineage for d1uhza1 (1uhz A:8-83)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190524Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2190525Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2190526Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2190585Protein staufen homolog 2 [110914] (1 species)
  7. 2190586Species Mouse (Mus musculus) [TaxId:10090] [110915] (1 PDB entry)
    Uniprot Q9D5N7 3-78
  8. 2190587Domain d1uhza1: 1uhz A:8-83 [107855]
    Other proteins in same PDB: d1uhza2, d1uhza3
    Structural genomics target

Details for d1uhza1

PDB Entry: 1uhz (more details)

PDB Description: solution structure of dsrna binding domain in staufen homolog 2
PDB Compounds: (A:) staufen (RNA binding protein) homolog 2

SCOPe Domain Sequences for d1uhza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhza1 d.50.1.1 (A:8-83) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]}
pisrlaqiqqarkekepdyillsergmprrrefvmqvkvgnevatgtgpnkkiakknaae
amllqlgykastslqd

SCOPe Domain Coordinates for d1uhza1:

Click to download the PDB-style file with coordinates for d1uhza1.
(The format of our PDB-style files is described here.)

Timeline for d1uhza1: