Lineage for d1uhza_ (1uhz A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904269Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1904270Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 1904271Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 1904330Protein staufen homolog 2 [110914] (1 species)
  7. 1904331Species Mouse (Mus musculus) [TaxId:10090] [110915] (1 PDB entry)
    Uniprot Q9D5N7 3-78
  8. 1904332Domain d1uhza_: 1uhz A: [107855]
    Structural genomics target

Details for d1uhza_

PDB Entry: 1uhz (more details)

PDB Description: solution structure of dsrna binding domain in staufen homolog 2
PDB Compounds: (A:) staufen (RNA binding protein) homolog 2

SCOPe Domain Sequences for d1uhza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgpisrlaqiqqarkekepdyillsergmprrrefvmqvkvgnevatgtgpnkki
akknaaeamllqlgykastslqdsgpssg

SCOPe Domain Coordinates for d1uhza_:

Click to download the PDB-style file with coordinates for d1uhza_.
(The format of our PDB-style files is described here.)

Timeline for d1uhza_: