Lineage for d1uhza_ (1uhz A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722458Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 722459Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 722460Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins)
    Pfam PF00035
  6. 722512Protein staufen homolog 2 [110914] (1 species)
  7. 722513Species Mouse (Mus musculus) [TaxId:10090] [110915] (1 PDB entry)
  8. 722514Domain d1uhza_: 1uhz A: [107855]
    Structural genomics target

Details for d1uhza_

PDB Entry: 1uhz (more details)

PDB Description: Solution structure of dsRNA binding domain in Staufen homolog 2
PDB Compounds: (A:) staufen (RNA binding protein) homolog 2

SCOP Domain Sequences for d1uhza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgpisrlaqiqqarkekepdyillsergmprrrefvmqvkvgnevatgtgpnkki
akknaaeamllqlgykastslqdsgpssg

SCOP Domain Coordinates for d1uhza_:

Click to download the PDB-style file with coordinates for d1uhza_.
(The format of our PDB-style files is described here.)

Timeline for d1uhza_: