SCOPe 2.06: Domain d1uhua1: 1uhu A:7-98

Lineage for d1uhua1 (1uhu A:7-98)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.6: MMLV matrix protein-like [81803] (2 proteins)
   automatically mapped to Pfam PF01140

6. Protein Product of RIKEN cDNA 3110009e22 [109876] (1 species)

7. Species Unclassified, murine endogenous retrovirus [TaxId:12908] [109877] (1 PDB entry)
   Uniprot O62708 7-98 # 73% sequence identity

8. Domain d1uhua1: 1uhu A:7-98 [107854]
   Other proteins in same PDB: d1uhua2, d1uhua3
   Structural genomics target

Details for d1uhua1

PDB Entry: 1uhu

PDB Description: solution structure of the retroviral gag ma-like domain of riken cdna 3110009e22

PDB Compounds: (A:) product of RIKEN cDNA 3110009E22

SCOPe Domain Sequences for d1uhua1:

Sequence; same for both SEQRES and ATOM records:

>d1uhua1 a.61.1.6 (A:7-98) Product of RIKEN cDNA 3110009e22 {Unclassified, murine endogenous retrovirus [TaxId: 12908]}
tplsltldhwseirsrahnlsveikkgpwrtfcasewptfdvgwppegtfdltvifevka
ivfqdgpgshpdqqpyitvwqdlvqnsppwik

Timeline for d1uhua1:

• d1uhua1 first appeared in SCOP 1.69, called d1uhua_
  
• d1uhua1 was called d1uhua_ in SCOPe 2.05
  
• d1uhua1 appears in SCOPe 2.07
  
• d1uhua1 appears in the current release, SCOPe 2.08