Lineage for d1uhua_ (1uhu A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1738766Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 1738767Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 1738823Family a.61.1.6: MMLV matrix protein-like [81803] (2 proteins)
    automatically mapped to Pfam PF01140
  6. 1738830Protein Product of RIKEN cDNA 3110009e22 [109876] (1 species)
  7. 1738831Species Unclassified, murine endogenous retrovirus [TaxId:12908] [109877] (1 PDB entry)
    Uniprot O62708 7-98 # 73% sequence identity
  8. 1738832Domain d1uhua_: 1uhu A: [107854]
    Structural genomics target

Details for d1uhua_

PDB Entry: 1uhu (more details)

PDB Description: Solution structure of the retroviral Gag MA-like domain of RIKEN cDNA 3110009E22
PDB Compounds: (A:) product of RIKEN cDNA 3110009E22

SCOPe Domain Sequences for d1uhua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhua_ a.61.1.6 (A:) Product of RIKEN cDNA 3110009e22 {Unclassified, murine endogenous retrovirus [TaxId: 12908]}
gssgssgtplsltldhwseirsrahnlsveikkgpwrtfcasewptfdvgwppegtfdlt
vifevkaivfqdgpgshpdqqpyitvwqdlvqnsppwiksgpssg

SCOPe Domain Coordinates for d1uhua_:

Click to download the PDB-style file with coordinates for d1uhua_.
(The format of our PDB-style files is described here.)

Timeline for d1uhua_: