SCOP 1.69: Domain d1uhua_: 1uhu A:

Lineage for d1uhua_ (1uhu A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.6: MMLV matrix protein-like [81803] (2 proteins)

6. Protein Product of RIKEN cDNA 3110009e22 [109876] (1 species)

7. Species Uncharacterised murive endogenous retrovirus [109877] (1 PDB entry)

8. Domain d1uhua_: 1uhu A: [107854]
   Structural genomics target

Details for d1uhua_

PDB Entry: 1uhu

PDB Description: solution structure of the retroviral gag ma-like domain of riken cdna 3110009e22

SCOP Domain Sequences for d1uhua_:

Sequence; same for both SEQRES and ATOM records:

>d1uhua_ a.61.1.6 (A:) Product of RIKEN cDNA 3110009e22 {Uncharacterised murive endogenous retrovirus}
gssgssgtplsltldhwseirsrahnlsveikkgpwrtfcasewptfdvgwppegtfdlt
vifevkaivfqdgpgshpdqqpyitvwqdlvqnsppwiksgpssg

Timeline for d1uhua_:

• d1uhua_ is new in SCOP 1.69
  
• d1uhua_ appears in SCOP 1.71
  
• d1uhua_ appears in the current release, SCOPe 2.08, called d1uhua1